Tirzepatide 10mg
Tirzepatide 10mg is a high-purity dual GIP and GLP-1 receptor agonist peptide for laboratory research on glucose regulation and metabolism.
Specifications:
Form: Lyophilized powder
Purity: ≥ 98%
Storage: Store in a cool, dry place away from light
Packaging: Sealed for stability
Disclaimer: For laboratory research purposes only. Not for human or animal consumption.
$200.00 Original price was: $200.00.$120.00Current price is: $120.00.
* For research purposes only. Not for human or animal consumption. This product is not a drug, food, or cosmetic and should not be used for any medical or therapeutic purposes.
Tirzepatide 10mg – Technical Information
Molecular Weight: 4813.57 g/mol
Sequence: YGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSKKKLQNAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRQPSLPQTDKPAQ
CAS Number: 2023788-19-2
Purity (HPLC): ≥ 98%
Physical Form: Lyophilized powder
Storage Instructions: Store at –20 °C, desiccated, protected from light
Frequently asked questions
No. All products sold by Spade Labs are strictly for laboratory and research use only and are not approved for human use or consumption.
We only sell to qualified researchers, labs, and institutions. Please ensure you have the appropriate credentials and documentation before placing an order.
Yes. Every peptide undergoes rigorous purity testing (e.g., HPLC or mass spec) before it’s issued. We guarantee consistent quality for your research needs.
For laboratory research use only. Not for human consumption, medical, veterinary, or diagnostic purposes. COA available upon request.

Reviews
Clear filtersThere are no reviews yet.