NAD+ 500mg
NAD+ 500mg Original price was: $200.00.Current price is: $120.00.
Back to products
IGF LR3
IGF LR3 Original price was: $120.00.Current price is: $72.00.

Tirzepatide 10mg

Tirzepatide 10mg is a high-purity dual GIP and GLP-1 receptor agonist peptide for laboratory research on glucose regulation and metabolism.

Specifications:

  • Form: Lyophilized powder

  • Purity: ≥ 98%

  • Storage: Store in a cool, dry place away from light

  • Packaging: Sealed for stability

Disclaimer: For laboratory research purposes only. Not for human or animal consumption.

Original price was: $200.00.Current price is: $120.00.

* For research purposes only. Not for human or animal consumption. This product is not a drug, food, or cosmetic and should not be used for any medical or therapeutic purposes.

Tirzepatide 10mg – Technical Information

  • Molecular Weight: 4813.57 g/mol

  • Sequence: YGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSKKKLQNAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRQPSLPQTDKPAQ

  • CAS Number: 2023788-19-2

  • Purity (HPLC): ≥ 98%

  • Physical Form: Lyophilized powder

  • Storage Instructions: Store at –20 °C, desiccated, protected from light

Frequently asked questions

Are your products safe for human consumption?

No. All products sold by Spade Labs are strictly for laboratory and research use only and are not approved for human use or consumption.

Who can purchase from Spade Labs?

We only sell to qualified researchers, labs, and institutions. Please ensure you have the appropriate credentials and documentation before placing an order.

Are your compounds tested for purity?

Yes. Every peptide undergoes rigorous purity testing (e.g., HPLC or mass spec) before it’s issued. We guarantee consistent quality for your research needs.

What can customers expect when ordering?
•Secure Checkout: Multiple payment options available (Crypto, Cash App, Zelle, SPADE tokens).
•Quick Fulfillment: Orders are processed promptly with fast and discreet shipping.
•Support: Transparent tracking and customer service you can rely on.
How does the SPADE token system work?
After launch, you’ll only be able to access ongoing discounts by using SPADE tokens—a pre-paid store credit you purchase on the site. Tokens are non-refundable and only redeemable for product. Early buyers lock in better rates, while token redemptions unlock savings and perks. 

For laboratory research use only. Not for human consumption, medical, veterinary, or diagnostic purposes. COA available upon request.

Customer Reviews

0 reviews
0
0
0
0
0

There are no reviews yet.

Be the first to review “Tirzepatide 10mg”

Your email address will not be published. Required fields are marked *